Purification and n-terminal sequencing of two presynaptic neurotoxic PLA2, neuwieditoxin-I and neuwieditoxin-II, from Bothrops neuwiedi pauloensis (jararaca pintada) venom
JOURNAL OF VENOMOUS ANIMALS AND TOXINS INCLUDING TROPICAL DISEASES(2007)
Abstract
Two presynaptic phospholipases A(2) (PLA(2)), neuwieditoxin-I (NeuTX- I) and neuwieditoxin-II ( NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (mu Bondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX- I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10 mu g/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0 +/- 8.0% ( n= 3; p< 0.05). NeuTX- I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve- diaphragm preparation, NeuTX- I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX- I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71% homology with bothropstoxin-II and 54% homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92% homology with Basp-III and 62% homology with crotoxin PLA2). The fact that NeuTX- I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX- I and NeuTX-II are Asp49 PLA2.
MoreTranslated text
Key words
chick biventer cervicis,loose patch clamp,nerve-muscle preparation,neuromuscular junction,neurotoxicity,PLA(2) neurotoxin,presynaptic action,Bothrops neuwiedi pauloensis,Neuwieditoxin-I,Neuwieditoxin-II
AI Read Science
Must-Reading Tree
Example
![](https://originalfileserver.aminer.cn/sys/aminer/pubs/mrt_preview.jpeg)
Generate MRT to find the research sequence of this paper
Chat Paper
Summary is being generated by the instructions you defined